PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA57G00347
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 342aa    MW: 39112.4 Da    PI: 6.0786
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA57G00347genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.8e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++++G g+W+t ++  g+ R++k+c++rw +yl
       AA57G00347 14 KGPWTAEEDQKLLDYINKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding521.6e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
       AA57G00347  67 RGRFSFEEEETIIQLHSFLGNK-WSAIAARLP-GRTDNEIKNFWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.6E-26564IPR009057Homeodomain-like
PROSITE profilePS5129424.069965IPR017930Myb domain
SuperFamilySSF466891.65E-3111108IPR009057Homeodomain-like
SMARTSM007171.2E-131363IPR001005SANT/Myb domain
PfamPF002492.3E-161461IPR001005SANT/Myb domain
CDDcd001677.47E-131661No hitNo description
Gene3DG3DSA:1.10.10.605.3E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129419.23466116IPR017930Myb domain
SMARTSM007171.4E-1566114IPR001005SANT/Myb domain
PfamPF002496.3E-1567111IPR001005SANT/Myb domain
CDDcd001671.39E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRSPCCEKT GLKKGPWTAE EDQKLLDYIN KHGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSFLGNKWS AIAARLPGRT DNEIKNFWNT HIRKKLLRMG  120
IDPVTHSPRL DLLDISSILA SSLYNSSSHH VNMSRLMMDA HRYHHHQQQQ QPLVNPEILK  180
LAASLFSQNQ NQNLVVDHQN INQTEVNQYQ TDRFENTTTQ ELQDFQSFTN EAQFNDVLDQ  240
FNGFGEQNLA SNTTTSVQDY NIPALNDYSG SEFVLDPCYS DQNMNFSSVL TTPSSSPATL  300
NSSSTTHINS SSCSTEDEIE SYCSNLMKFD FSDFLDVNGF II
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006413779.10.0hypothetical protein EUTSA_v10027571mg
TrEMBLA0A078JE850.0A0A078JE85_BRANA; BnaC01g41180D protein
STRINGBra013526.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-168MYB-like 102